| St_Aardvark_the_Carpeted_vs__Texe_Marrs An interview with NWO-watcher and preacher Texe Marrs, and a leap into the wilder worlds of conspiracy, Aardvarks and Ayn Rand. |
| TheConspiracy A nearly complete archive of Brian Redman's 1994-1998 Conspiracy Nation newsletter. |
| The_Truth_Seeker Behind the headlines - conspiracies, cover-ups, and ancient mysteries. Real news and perspectives that one won't find in the mainstream media. |
| Truthseekers_Network Articles, video and audio on a wide range of topics. |
| University_of_Toronto_Fraud Explains how the University of Toronto and the media conspire to keep a fraudulent affair hidden from the public. |
| Violently_Racist_Music Site detailing how the MTV Video Music Awards have been given to artists who promote messages that call for the murder of whites. |
| Weirdload Essays from the edge, covering secrets and conspiracies from those involving the Roman Catholic Church to UFOs, space and metaphysics. |
| Xenophobic_Persecution_in_the_U_K_ Exposes an MI5 operation of illegal harassment through the UK media, public molestation, and verbal abuse. |
| You_Be_The_Judge_and_Jury Online book documenting crimes committed by the Federal Reserve, IRS, U.S. Government. |
| Discrimination_Against_Transgendered_People Summary of existing case law in the U.S., including employment discrimination, parental issues, marriage, immigration, and prison issues; authored by Shannon Minter, senior staff attorney, National Ce |
| Transgender_Equality__A_Handbook_for_Activists_and_Policymakers Guide to passing transgender-inclusive non-discrimination legislation with introduction to transgender issues, language for legislation, talking points, comprehensive resource listing. 96-page book i |
| Transgender_Issues_and_ual_Orientation A 1997 issue of the National Journal of ual Orientation Law, including three articles, and a brief to the European Court of Human Rights in the case of X,Y, and Z v. UK. |
| Transgender_Law_and_Policy Up-to-date listing of all U.S. laws that are transgender-inclusive; quality articles and resources on legal issues affecting transgendered and gender variant people. Intended for activists, policymake |
| Transgender_Law_Center Civil rights organization advocating for transgender communities. Features mission, board, staff, services, clients and client stories. Based in San Francisco, CA. |
| Air_Force_Technology_Industry_Projects Project profiles. |
| Air_Refueling_Operations_Planning Describes a computer program that enables rapid planning and optimization of Air-to-Air Refuelling operations for military Tanker and Receiver aircraft. |
| Hampton_Roads_Squadron_-_Association_of_Naval_Aviation Advocate for naval aviation, carrier projection, maritime patrol, rotary wing, special mission, and logistics support. Includes mission, headquarter information, and museum details. |
| NATO_Tiger_Association Information and news concerning selected aviation units. |
| The_BIKE_sight_of_Life Personal page of a biker with a memory of his motorcycle and a little warning for other bikers. |
| 10%er_Brotherhood Mission - to educate people to the fact that being a "biker" isn't bought. It's a piece of history - it's a lifestyle - it's a brotherhood. |
| The_Harley Jerry's Harley Davidson Motorcycle and Pictures of Sturgis, Bean Blossom, 95th Reunion, and many other events. |
| In_the_Wind_Forum An MSN forum for bikers. |
| InjuredBiker_-_Support_for_Downed_&_Disabled_riders Support, rehab assistance, resources, news, & fun for downed Bikers and their friends. |
| Jerry_Palmer JP Audio, a professional sound and lighting company. Classic collection of leather biker jackets and motorcycle boots. Harley Davidson Motorcycles. Skydiving Pictures. |
| Mad_Maps Maps and roadtrip information by bikers for bikers. |
| Milk_bar_cowboys_of_the_1940\'s,1950\'s,1960\'s Photos and reviews of the groups known as milk bar cowboys, unruly motorcycle groups in the 1940's to 1960's. |
| Motorcycle_Menace__Media_Genres_and_the_Construction_of_a_Deviant_Culture Doctoral dissertation on the motorcycle and outlaw biker clubs in American culture. Explores how images are exploited in the mass media, whereas biker magazines such as Easyrider celebrated biker life |
| Open_Road_Radio Internet radio show featuring motorcycle news and events. |
| Steel_Horse Official web site for Steel Horse television and Indiana's online biker community. Provides local coverage on motorcycle news, events, hot spots, weather, merchants, people and places. |
| World_Wide_Toy_Run Call to action. Global effort to bring toys to children whose parents are deployed. Join the Bikers for Freedom Against Terrorism make the holidays good for children the world over. |
| Blood_Dance__Goth Azhrarn gives a detailed description of modern Gothic culture and its history, featuring images and articles. |
| The_Dark_Side Image database, text files, net-goth gallery, club listings, and links. |
| DarkHeaven Angel and MyLo host a Gothic forum and provide brief articles on Gothic themes, including music, dark books and movies. |
| An_Early_History_of_Goth Pete Scathe outlines the beginnings of the Goth movement between 1979 and 1984, and looks at the influences on its development, including bands and fashion. |
| Goth_To_Be_Different A site dedicated to the people who reign the night, the Gothic people. |
| Goths_for_Jesus Inverted Goth's articles on Jesus and Christianity from the view of the dark culture, and a forum. |
| Release_Me Hundreds of pictures of abandoned places, thousands of haunting places, serial killers, phobias, ghostly pictures, and urban legends. |
| RelgiousTolerance_org__The_Goth_Culture B.A. Robinson dispels some of the myths and preconceived notions about Goths, with references. |
| Sunlight_and_Shadow__Understanding_the_Gothic_Subculture Jennifer Pitcock aims to dispel the myths and misconceptions surrounding the Gothic subculture, in an effort to promote tolerance and understanding. |
| Stop_the_False_Alarmism Standard-Times article pleading to end stereotyping of students based on appearance and interests, particularly goths. (November 27, 2001) |
Purchasing DEDI's LDC
Liquid Deprenyl Citrate (LDC) contains 99.99+% pure Selegiline as it's active ingredient. LDC is a brand name product, developed in the early 1990s by Discovery Experimental & Development Inc. Clinical trials show LDC is the only deprenyl product that does NOT contain amphetamine or methamphetamine by-products. Therefore it does not produce the extreme adverse side-effects associated with those dangerous and addictive narcotics. No deprenyl product exists that has a chemical structure similar to LDC, though one terribly unethical company (documented below) does exist that fraudulently calls their product "Liquid Deprenyl Citrate" in scrambled words.Several doctors and countless consumers consider LDC to be one of the most important products in the world. Individuals suffering from numerous numerological diseases, medical conditions, and aging side-effects have documented LDC's extreme effectiveness. Patients suffering from deadly diseases, such as Parkinson's and Alzheimer's fiercely believed LDC was the only reason they were alive. Individuals suffering from neurological diseases (or similar) that left them wheelchair-bound regained the ability to walk. Individuals suffering from numerological diseases that made their body so stiff they could not even move their lips regained the ability to speak. s suffering from chronic depression since they were teenagers finally found relief, a product that made their depression disappear with "NO side-effects." All of the above individuals thought of LDC as a lifeline. LDC enabled all above individuals to take care of themselves, to live by themselves, and to be independent.. It gave so many people a second chance at life.For another group of individuals (age 35 and up), LDC prevented such horrible things from happening. To sum up all basic scientific findings and clinical trials, 99.99% pure Selegiline makes a person feel very young again. Clinical trials show 99.99% pure Selegiline increases life-span by 40% at a minimum. LDC also has other capabilities, it has been exclusively tested and clinically proven to revive dying brain cells and so much more. The list of effects LDC is able to produce (for review on this page), is incredibly long. While there is no doubt some need it much more then others, it is almost always beneficial to anyone over 35, and beneficial to others much younger suffering from certain diseases or conditions.The Unexpected RealitySadly, LDC is not available at the present time. The FDA shut down DEDI, claiming DEDI sold LDC as an unapproved drug, when Somerset Pharm. had orphan rights to Deprenyl. However, Somerset Pharm. only had orphan rights to Selegiline Hcl., which is a totally different substance from LDC with a totally different chemical structure. DEDI battled the FDA's claims for 10 years and lost in the end. This is documented in detail on the Liquid Deprenyl Story Page. Since LDC has proven itself through countless scientific trials and thousands of customer reports, it remains highly sought after. Many health companies know this, and will do whatever they can to make consumers believe their products will produce the same effects DEDI's LDC can.However, such a product is nonexistent, simply because there is no product available today that is 99.99+% pure Selegiline. No supplement company has the teams of doctors, scientists and hundreds of thousands of dollars to invest to maybe look into discovering some procedures. Attempting to make 99.99+% pure Selegiline from "scratch" would require investments of millions and millions of dollars. No multi-billion dollar Pharmaceutical company even makes pure Selegiline. Anyone purchasing a Deprenyl product from a vitamin or supplement company and not a pharmacy is making a serious mistake and putting their health at risk. While no pure Selegiline exists at the present time, Deprenyl products made up of highly impure Selegiline Hydrochloride (Hcl.) are available far and wide. Of course it is difficult to impossible for the public to come across that information. And while this website exists for LDC, it also exists to inform the public of a fraudulent product that attempts to imitate LDC by displaying explicit lies and misleading statements on it's label.Cyto Pharma produces Cyprenil and Selepryl, both are the exact same liquid Selegiline Hydrochloride product, highly contaminated with amphetamine and methamphetamine, more so than any other Deprenyl on the market. Cyto Pharma calls their products "Deprenyl Liquid, Selegiline Citrate," scrambling the words "Liquid Deprenyl Citrate" and "Selegiline Citrate." It is beyond fraudulent for a company to deceive consumers and make them believe they are selling another company's brand name product. It is also fraudulent for Cyto Pharma to call their products "Selegiline Citrate", as their product has a TOTALLY different structure then the chemical entity Selegiline Citrate. Fraudulent Cyto Pharma plays off feelings of those who researched LDC and need it to live, and individuals who are desperate to find answers for their loved ones. Cyto Pharma is helped along by a particular large unethical distributor, which is documented in depth on this website and uses business practices nearly as unethical and disgusting as Cyto Pharma's.If you have purchased a liquid deprenyl, or are thinking of purchasing any Deprenyl product, it is highly recommended you first view the LDC Vs. Selegiline Hcl. page, and also view the Fraudulent Companies Page to learn of the unspoken side of all Selegiline Hydrochlorides and to be made aware of the 1 fraudulent manufacturing company.Fraudulent Companies PageIndividuals worldwide are working hard to bring LDC back onto the market. It is very difficult to achieve that goal, and it may be lengthy. Any individual that is serious about obtaining LDC should offer their help in legalizing it to make it available in their country.If you believe Liquid Deprenyl Citrate should be legalized please send your thoughts to: publicthts@liquiddeprenyl.comIf you very much want LDC available and believe you can be a major help because of your career position or position in life, please send an email to legalize@liquiddeprenyl.com.This website is constantly updated. Anyone with any type of question about any subject addressed on this website may send an e-mail to ldcinfo@liquiddeprenyl.com.Clinical TrialsAmphetamines In Selegiline Hcl.Clinical trials were conducted to discover if Deprenyl products contained amphetamine or methamphetamine, as both narcotics are potential by-products of the Selegiline manufacturing process. Deprenyl Products tested: Eldepryl, Liquid Deprenyl Citrate, and Cyprenil & Selepryl. The latter and Eldepryl contain impure Selegiline Hcl, while LDC contains 99.99+% pure Selegiline. Both Selegiline Hcl. Products were found to be contaminated with amphetamine and methamphetamine, in varying amounts, with Cyto Pharma containing the highest amount... View More
LDCAll DeprenylsVs.(Selegiline)(Selegiline Hcl.)Liquid Deprenyl Citrate - Selegiline Citratecomposed of 99.99+% pure Selegiline freebase bonded with citric acid.Eldepryl - Selegiline Hydrochloridecontains impure Selegiline fused with hydrochloric acid. This conjugate molecule is called Selegiline Hydrochloride.Both of the above are different in chemical structure and solubility, with LDC more lipid soluble. Solubility differences reflect different physiological properties. continue readingSilvicidal is the AIDS - HIV cure. Silvicidal is classified in the most generally sense as a Colloidal Silver. Under the Colloidal Silver classification, it is more closely classified as a Mild Silver Protein or MSP. Cryptococcus Neoformans is a very deadly bacteria, as is E. Coli (escherichia coli). However, one just as deadly, if not more dangerous is enterococcus - Penicillin resistant because of many strains of this infection ARE anti-biotic resistant. pseudomonas aeruginosa details staphylococcus aureus information streptococcus pneumoniaeborrelia burgdorferi b31 page Lyme Disease borrelia hermsii hs-1 page candida albicans Lyme Disease PageMild Silver ProteinMSPColloidal SilverSilvicidalSilvicidal 350Silvicidal GSSilvicidal MistSilvicidal NDSilviGelColloidal GoldCellStatCellStat PlusPro-Cell 40Pro Cell 40ProCell 40Vitamin CL-Ascorbic Acid99.9% L-Ascorbic AcidAscorbic AcidStrictly SupplementsStrictly Supplementspure vitamin C L ascorbic acidpure DHEA procell purest liquid DHEAAmber StaklinskiMSPColloidal SilverSilvicidalAIDS HIVVRPVitamin Research ProductsVRPVRPVRPVRPVRPVRPVRPVRPGHI/MRI GHI MRIGHI/MRI GHI MRIGHI/MRI GHI MRIGHI/MRI GHI MRIGHI/MRI GHI MRIGlobal Health Information Medical Research InstituteStrictly SupplementsAmber StaklinskiThese Pages have the most up to date information concerning Discovery Experimental:myspacegooglet4mmyspace.comm4myoutubeedenebayyahoow4wyahoo.comm4whotmailyou-tubegoogle.comnarutomw4mbebofacebook8ballmapquestmsnpageryahoo mailmw4mwlovegamesamghondamy spacehotmailbritney spearscraigslistparis hiltoncleanlimewirewikipediamynetfinancemusicwwebmwcarslil wayneebayTo view information concerning Colloidal Silver, it would be best to view our Colloidal Silver Research Page for the most accurate and updated info regarding Colloidal Silver.The following pages accurately explain Discovery Experimental:toyotaasianmoviesthemesbeyoncemw4wrunescapemustangpokemongmaildesktop.comjessica albachattagoyunlarsnookermapschris brownaol.comemohotelsbasicjobsorkutpspanimeharry potterundefinedvideotravelrihannaproductpagedetailpowersell annuityponeyyoutube.comgirlsipodavril lavigneskyblogoyunpogo.comwallpapersassmsn.comThese Pages have the most up to date information concerning GHI/MRI:myspacegooglet4mmyspace.comm4myoutubeedenebayyahoow4wyahoo.comm4whotmailyou-tubegoogle.comnarutomw4mbebofacebook8ballmapquestmsnpageryahoo mailmw4mwlovegamesamghondamy spacehotmailbritney spearscraigslistparis hiltoncleanlimewirewikipediamynetfinancemusicwwebmwcarslil wayneebayThe following pages accurately explain GHI/MRI:toyotaasianmoviesthemesbeyoncemw4wrunescapemustangpokemongmaildesktop.comjessica albachattagoyunlarsnookermapschris brownaol.comemohotelsbasicjobsorkutpspanimeharry potterundefinedvideotravelrihannaproductpagedetailpowersell annuityponeyyoutube.comgirlsipodavril lavigneskyblogoyunpogo.comwallpapersassmsn.comThese Pages have the most up to date information concerning Strictly Supplements:myspacegooglet4mmyspace.comm4myoutubeedenebayyahoow4wyahoo.comm4whotmailyou-tubegoogle.comnarutomw4mbebofacebook8ballmapquestmsnpageryahoo mailmw4mwlovegamesamghondamy spacehotmailbritney spearscraigslistparis hiltoncleanlimewirewikipediamynetfinancemusicwwebmwcarslil wayneebayThe following pages accurately explain Strictly Supplements:toyotaasianmoviesthemesbeyoncemw4wrunescapemustangpokemongmaildesktop.comjessica albachattagoyunlarsnookermapschris brownaol.comemohotelsbasicjobsorkutpspanimeharry potterundefinedvideotravelrihannaproductpagedetailpowersell annuityponeyyoutube.comgirlsipodavril lavigneskyblogoyunpogo.comwallpapersassmsn.comHome Page | How to Use This Site | LDC Information | News | Articles | Contact